<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4059 4059-30716 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_ES, L210W D67DE Y181YC   S68SN, W88C, A98S, K122E, Q207QP, R211K, L228H  
>4059-30716| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKENTKWRKLVDFRELNKRTQDFCEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRPHLWKWGFTTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, G48V, I50V, I54T, V82A L33I, Q58E L10I, I13V, K20R, E34Q, E35D, M36I, L63P, A71I, I72V, I93L  
>4059-30716| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVIQDINLPGRWKPKIIVGVGGFTKVREYDQIP
IEICGHKIVGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006