<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4024 4024-30604 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, N88NS K43T L10I, I13IV, I15V, K20R, E35D, M36I, N37D, L63P  
>4024-30604| codons 4-99
TLWQRPIVTVKVGGQLREALLDTGADDTILEDIDLPGRWTPKLIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRSLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, V75T, M184V, L210W, T215Y K219E K103N V108I, L234I V60I, T69N, A98S, K122E, G196GE, E203K, Q207E, R211K, D218E, K223T, L228H  
>4024-30604| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSNKWRKITDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIKELREHLWKWGFYTP
EEKHQTEPPFHWMGYEIHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006