<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4037 4037-30507 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, L210W, T215F K219E Y181C, G190A K101H, V108VI K66R, T69N, V118VI, K122E, Q207E, D218E, L228R  
>4037-30507| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKRNSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELREHLWRWGFFTP
EEKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, V11I, L33LF, G73S I13V, L19I, K20I, E35D, M36ML, K55R, I62V, L63P, C67F, H69R, A71V, I72L, N83S, T91S  
>4037-30507| codons 4-99
TLWQRPFITVKIGGQIIEALLDTGADDTVFEDLNLPGRWKPKIIGGIGGFVRVRQYDQVP
IEIFGRKVLSTVLVGPTPVSVIGRNLMSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006