<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4092 4092-30410 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M K219E Y181C   S68G, K122Q, I135V, L168*, I178L, V179I, R211K, L228R, V245VA D113H
>4092-30410| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFAIKRKDGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGHAYFSVPLDQDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKI*EPFRKQNPDLIICQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTP
DEKHQKEPPFRWMGYELHPDKWTVQPIAL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, V77I, I93L  
>4092-30410| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006