<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4091 4091-30325 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, M184V, T215Y D67H, K219E     T39A, T69N, A98S, K122E, I135T, T200A, L228H, V245M  
>4091-30325| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKHSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V, L90M L33F L10I, I13V, K14R, E35D, N37S, K55KR, Q61QH, I62V, L63P, I66IV, H69R, A71T, I72E, I93L, C95F  
>4091-30325| codons 4-99
TLWQRPIVTVRIGGQLKEALLDTGADDTVFEDMSLPGRWKPKIIGGIGGFVRVRQYDHVP
IEVCGRKTEGTVVVGPTPVNVIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006