<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4078 4078-30324 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V T215S Y181C, G190A   A98S, V106I, K122E, V179I, T200A, Q207N, K223KR, Q242R K101V
>4078-30324| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
SGLVKKKSITVLDVGDAFFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYVDDLYVASDLEIGQHRAKIEELRNHLLRWGFSTP
DKKHQREPPFLWMGYELHPDKWTVRPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82S, L90M   L10I, K20R, E35D, M36I, N37D, R57K, I62V, L63P, A71T, I93L, C95F  
>4078-30324| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFVKVKQYDQVP
IEICGHKTIGTVLVGPTPSNIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006