<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4073 4073-30305 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54V, I84V, L90M L10F, V11I, L33LI, N88D T12S, I15V, L19Q, K20I, E35D, M36I, N37D, Q61QH, L63P, A71T, I85V, Q92R T91TCS
>4073-30305| codons 4-99
TLWQRPFISIKVGGQQIEALLDTGADDTVIEDIDLPGRWKPKIVGGIGGFVKVRQYDHIP
IEICGHKTIGTVLVGPTPVNVVGRDLMSRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L210W, T215Y V75M, K219DH K103N, Y181C V108I T39A, V60I, K101KQ, K122E, I135T, E194K, G196E, E203EK, H208HY, R211K, D218E, L228H, Q242K K223PT
>4073-30305| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLQKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLKIEQHRTKIKELRQYLWKWGFYTP
EHKHQTEPPFHWMGYELHPDKWTVKPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006