<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4071 4071-30227 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54V, I84V, L90M G73S, L89V L10H, I13V, I15IV, K20I, E35D, M36I, N37D, L63P, A71V, T91S, I93L  
>4071-30227| codons 4-99
TLWQRPHVTVKVGGQLIEALLDTGADDTVLEDIDLPGRWKPKIVGGIGGFVKVRQYDQIP
IEICGHKVISTVLVGPTPVNVIGRNVMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, Y115YF, M184MV, T215Y   L100I, Y188L   V90VI, K122E, I135V, T139TA, V179VI, G196E, T200TK, V245K  
>4071-30227| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEIQLGIPHP
AGIKKKKSVTVLDVGDAFFSVPLDEDFRKYTAFTIPSVNNEAPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLLVGSDLEIEQHRKKIEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006