<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4069 4069-30225 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R K101E, G190GS   K43E, E44A, V60VI, V118I, K122E, E138EQ, K166R, V179VI, R211K  
>4069-30225| codons 38-247
CTELEEAGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIIIYQYMDDLYVSSDLEIGQHRTKIEELRQHLWKWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46I, I47IV, I54IV, I84V, L90M L10FI, V11I, L33F, G73T L63P, A71V, I72IT, V77I, I93L  
>4069-30225| codons 4-99
TLWQRPIITIKIGGQLKEALLDTGADDTIFEEMNLPGRWKPKIVGGIGGFVKVRQYDQIP
IEICGHKVTTTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006