<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3114 3114-30722 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V L10F, L24I, L33LF T12Q, E35D, M36I, R41K, L63P, I64IV, A71V, I72V, Q92R T91TCS
>3114-30722| codons 4-99
TLWQRPFVQIKIGGQLKEALIDTGADDTVFEDINLPGKWKPKIIGGIGGFVKVRQYDQIP
VEICGHKVVGTVLVGPTPTNVIGRNLLSRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219Q     T39K, K43Q, E44D, V60I, V118I, K122E, I135T, S162C, E203K, Q207E, R211K, D218E  
>3114-30722| codons 38-246
CKELEQDGKISKIGPENPYNTPIFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIKELREHLWKWGFYTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006