<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3043 3043-30320 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48A, I54V, V82A, I84V, L90M K43T L10I, I15V, K20R, E35D, M36I, N37D, L63P, I64V, I85V  
>3043-30320| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGRWTPKLIAGIGGFVKVRQYDQIP
VEICGHKAIGTVLVGPTPANVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215F K219Q K103N, Y181C   K122E, K173R, I202V, R211K, L228HR H235HR
>3043-30320| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRRQNPDIVICQYVDDLYVGSDLEIGQHRTKVEELRQHLWKWGFFTP
DQKHQKEPPFRWMGYELRPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006