<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3036 3036-30311 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M L10F, G73T I15V, K20M, L63P, I64V, C67D, H69R, A71V, I93L  
>3036-30311| codons 4-99
TLWQRPFVTIKVGGQLMEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYDQIP
VEIDGRKVITTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75VIM K103N V108I T39TA, S48T, V60I, K101Q, V118VI, D121H, K122E, I135T, D177E, V189I, T200I, I202V, R211K, E224D, D237E  
>3036-30311| codons 38-247
CAELEKEGKITKIGPENPYNTPIFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLQKNKSVTILDVGDAYFSIPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYVDDLYIGSDLEIGQHRIKVEELRQHLWKWGFYTP
DKKHQKDPPFLWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006