<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3073 3073-30814 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A L10F, L33LF, K43T K20KT, M36MI, K55R, L63P, I64V, T74S, I85V  
>3073-30814| codons 4-99
TLWQRPFVTIKIGGQLTEALLDTGADDTIFEEINLPGRWTPKIVGGIGGFMRVRQYDQIP
VEICGHKAIGSVLVGPTPANIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K103N   K64KR, A98AS, K122E, D123N, D177E, I178V, F214L  
>3073-30814| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEVVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006