<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3127 3127-30514 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y K70T, K219D Y188L   T39A, S68R, V106I, V118I, D123E, V179I, Q207R, H208Y, R211K, D218E, L228H  
>3127-30514| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNRDTWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYMDDLLVGSDLEIGQHRTKIEELRRYLWKWGFYTP
EDKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T L10I, K20I, R41K, K55R, I62V, L63P, C67F, V77I, I93L  
>3127-30514| codons 4-99
TLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIRVRQYDQVP
IEIFGHKAITTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006