<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3183 3183-30515 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y D67G, K70A, V75A, K219Q K103KN   E40F, K43E, S68G, A98S, K102KR, V118I, K122E, S162SDGN, H208Y, R211K, D218E  
>3183-30515| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKGGTAWRKIADFRELNKRTQDFWEVQLGIPHP
SGLKRNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M L33F, G73S L10I, I13V, K20R, E35D, M36I, N37D, K55R, I62V, L63P, A71T, I72E, I93L, C95F  
>3183-30515| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVFEDIDLPGRWKPKIIGGIGGFVRVRQYDQVP
IEICGHKTESTVLVGPTPANVIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006