<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3088 3088-30501 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I K219Q K103N, Y181YC, G190A V108VI T39A, S48T, K64N, K122E, I135T, E138EQ, I142IT, E203A, F214FL, H221Y  
>3088-30501| codons 38-247
CAEMEKEGKITKIGPENPYNTPVFAINKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSTNNQTPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIAELRQHLLRWGLTTP
DQKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I50V, I54S, V82ACGS, L90LM   L10I, E34Q, Q61H, L63P, I64V, A71V, V77I, I93L  
>3088-30501| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMNLPGRWKPKIIVGVGGFSKVRQYDHIP
VEICGHKVIGTVLIGPTPSNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006