<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3009 3009-30225 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M V11VI, L33F, K43T, T74TP L10IV, I13V, N37D, K55KR, Q61QH, L63P  
>3009-30225| codons 4-99
TLWQRPVITVKIGGQLKEALLDTGADDTVFEEMDLPGRWTPKLIGGIGGFVRVRQYDHIP
IEICGHKAIGPVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103N V108I S68SN, K122E, T165I, V189I, G196K, T200A, I202V, Q207E, R211K, H221Y, K238S D113N
>3009-30225| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDNTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGNAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIVIYQYVDDLYIGSDLEIKQHRAKVEELREHLWKWGFYTP
DKKYQKEPPFLWMGYELHPDSWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006