<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3084 3084-30822 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74IV, M184V, T215Y V75A, K219N L100I, K103N   K43E, E44D, I47L, K73M, K102Q, V118I, K122KE, D123DE, S162D, D177E, G196E, T200TA, E203Q, L210S, R211K, D218E  
>3084-30822| codons 38-247
CTELEEDGKLSKIGPENPYNTPVFAIKKKNSTKWRMVADFRELNKRTQDFWEVQLGIPHP
AGIKQNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRAKIQELRQHLSKWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48A, I54V, V82S L24I, K43T L10I, K20R, E35D, M36I, R57K, I62V, L63P, I64V, A71V, T74S, V77I, I93L  
>3084-30822| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVLEDINLPGRWTPKMIAGIGGFVKVKQYDQVP
VEICGHKVIGSVLIGPTPSNIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006