<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1618 1618-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L10F, L33LI, Q58E, N88D, L89V I13V, A22V, M36I, R41K, R57RK, L63P, A71T, T74K, N83S, T91A  
>1618-30821| codons 4-99
TLWQRPFVTVKIGGQLKEVLLDTGADDTVIEEINLPGKWKPKIIGGIGGFVKVKEYDQIP
IEICGHKTIGKVLVGPTPVSVIGRDVLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, T215Y K219R K103N V108VI V60I, D123E, S162C, I178L, E203D, H221Y, V245E  
>1618-30821| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRTKIDELRQHLLRWGFYTP
DRKYQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006