<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2309 2309-30804 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, I84V, L90M K43T, L89LV L10I, E34EQ, N37D, D60E, Q61R, L63P, A71V, T91TA, I93L  
>2309-30804| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMDLPGRWTPKMIVGIGGFVKVRQYERIP
IEICGHKVIGTVLVGPTPANVIGRNVMAQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M, M184V A62V, V75I, F77L, F116Y K103N P225PH K64R, S68R, K122E, I167V, G196E, T200A, I202V  
>2309-30804| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIRRKDRTKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKVLEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRAKVEELRQHLLRWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006