<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1299 1299-30714 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74I, V75T, M184V, L210W, T215Y K219D Y181C, G190A K101H, V108I K49KR, K122E, I142IT, S162A, Q174QK, E203K, R211K, D218E, D237E  
>1299-30714| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKNSTKWRKITDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKKNPDIVICQYVDDLYVASDLEIGQHRTKIKELRQHLWKWGFYTP
EDKHQKEPPFLWMGYELHPEKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, V82A, L90M K43T, F53L L10IV, I13IV, K20R, E35D, M36I, N37DE, I62V, L63P, I66F, A71I, I72V  
>1299-30714| codons 4-99
TLWQRPVVTVKIGGQLREALLDTGADDTILEDIELPGRWTPKIVGGIGGLLKVRQYDQVP
IEFCGHKIVGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006