<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2192 2192-30822 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, V11I, G73T T4S, T12K, I15V, L19P, K20I, A22V, M36I, I62V, L63P, I64IV, C67F, H69R, A71V, N83S, I85V, T91S  
>2192-30822| codons 4-99
SLWQRPFIKIKVGGQPIEVLLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYDQVP
VEIFGRKVITTVLVGPTPVSVVGRNLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219Q K103N A98G V60I, T69N, K122E, S162SN, I167IV, I178IM, G196E, I202IV  
>2192-30822| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKVLEPFRKQNPDMVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006