<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1261 1261-30320 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82C, I84V, L90M L10F, L33F, F53L, T74P I13V, K55R, D60E, I62V, L63P, I66F, A71V, I72V, T91TS  
>1261-30320| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIGGIGGLVRVRQYEQVP
IEFCGHKVVGPVLVGPTPCNVIGRNLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74LI, L210W, T215Y V75LS, K219N K103N, Y181C   T39A, E44D, V118I, D123E, S162SACG, D177E, H208Y, R211K, D218E  
>1261-30320| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKISDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQGSMTKILEPFRKQNPEIVICQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006