<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1255 1255-30409 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V V11VI L10I, I13V, K20RT, A22V, E35G, M36I, N37S, R41K, R57K, D60DE, Q61QH, I62IV, L63P, K70R, A71V, I93L  
>1255-30409| codons 4-99
TLWQRPIITVKIGGQLTEVLLDTGADDTVLEGISLPGKWKPKMIGGIGGFVKVKQYEHVP
IEICGHRVIGTVLVGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M A62V, V75I, F116Y K103N P225H S68N, A98S, D123E, D177E, T200A, R211K F214M
>1255-30409| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDNTKWRKLIDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYYSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGMTTP
DKKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006