<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1254 1254-30319 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, V82A, I84V, L90M L10F, L33F, Q58E, G73S I13V, L19V, E34Q, D60E, I62V, L63P, A71V  
>1254-30319| codons 4-99
TLWQRPFVTVKIGGQVKEALLDTGADDTVFQEMNLPGRWKPKIIGGIGGFLKVREYEQVP
IEICGHKVISTVLVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, Y115F, Q151M, M184MV, T215F F116Y, K219Q K103N   V60I, K64H, T69N, A158S, S162Y, Q197H, I202V, H208Y, R211K, D218E, L228H, V245VE  
>1254-30319| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIHKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAFYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
SIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGHHRTKVEELRQYLLKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006