<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1247 1247-30214 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82A, L90M L10F, V11I, L33F I13V, K55R, I62V, L63P, I66V, A71V, I93L, C95F  
>1247-30214| codons 4-99
TLWQRPFITVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIGGIGGFLRVRQYDQVP
IEVCGHKVIGTVLVGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210W, T215Y V75M K103N A98AG, V108VI T39A, K43E, E44D, V118I, K122E, I135T, T165L, R211K, L228I  
>1247-30214| codons 38-247
CAELEEDGKISKIGPENPYNTPVFAIKKKDSTKWRKVMDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMLKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFIWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006