<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1896 1896-30623 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M L33F, G73GS L10I, I62V, L63P, I64L, I66V, A71T, V77I, I93L, C95F  
>1896-30623| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTIFEEMNLPGRWKPKIVGGIGGFMKVRQYDQVP
LEVCGHKTISTVLIGPTPVNIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74V, M184V K219Q K103N, Y181C   T39A, V60I, V118I, D123E, I135T, S162SG, T165TI, R211RK, F214L, H221Y, V245T  
>1896-30623| codons 38-247
CAEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQGSMIKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTP
DQKYQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006