<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1785 1785-30502 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, I84V, L90M L10F, G73S, L89V I13V, Q18H, K20T, L33V, E35EDG, M36MI, N37NK, R57K, I62V, L63PS, A71V, I72L  
>1785-30502| codons 4-99
TLWQRPFVTVKIGGHLTEALLDTGADDTVVEGIKLPGRWKPKIIGGIGGFMKVKQYDQVS
IEICGHKVLSTVVVGPTPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y K219N L100I, K103N   K43E, K64KR, V118I, K122E, K166R, V179I, I202V, E203K, H208Y, R211K, K223E, L228R  
>1785-30502| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIRKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRTKVKELRQYLWKWGFYTP
DNKHQEEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006