<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1651 1651-30326 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M L10F, L33F, Q58E, G73ST E34Q, R41K, I62V, L63P, I66IF, C67CY, A71T, I72K, V77VI, P79D, I93L  
>1651-30326| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTVFQEMNLPGKWKPKLIGGIGGFVKVREYDQVP
IEFYGHKTKTTVLIGDTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, T215Y K219KN     K43R, E44D, K122E, D123DN, Q174QE, G196E, E203EK, Q207E, H208Y, R211RK, K223E  
>1651-30326| codons 38-247
CTELERDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKENPDIVIYQYVDDLYVGSDLEIEQHRTKIKELREYLLKWGFYTP
DNKHQEEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006