<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1243 1243-30312 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, V82T, L90M V11I L10I, T12IV, I15V, G16E, L19P, K20I, M36I, N37S, K55R, R57K, I62V, L63R, K70I, A71V, I85V, L89I R41K_K
>1243-30312| codons 4-99
TLWQRPIIVIKVEGQPIEALLDTGADDTVLEEISLPGKWKPKIIGGIGGFMRVKQYDQVR
IEICGHIVIGTVVVGPTPTNIVGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y K219R   V108VI K43Q, E44D, T69TN, T107TS, L109I, V118I, K122E, I135T, I142V, T165I, G196E, I202V, D218E, L228K  
>1243-30312| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVSIIDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLWRWGFYTP
ERKHQKEPPFKWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006