<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1243 1243-30312 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, V82T, L90M V11I L10I, T12IV, I15V, G16E, L19P, K20I, M36I, N37S, R41K_K, K55R, R57K, I62V, L63R, K70I, A71V, I85V, L89I  
>1243-30312| codons 4-99
TLWQRPIIVIKVEGQPIEALLDTGADDTVLEEISLPGKWKPKIIGGIGGFMRVKQYDQVR
IEICGHIVIGTVVVGPTPTNIVGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y K219R   V108VI K43Q, E44D, T69TN, T107TS, L109I, V118I, K122E, I135T, I142V, T165I, G196E, I202V, D218E, L228K  
>1243-30312| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVSIIDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLWRWGFYTP
ERKHQKEPPFKWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006