<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1765 1765-30516 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54V, V82T, L90M L33F, F53L, G73S L10I, I15V, K20R, E35D, M36L, N37E, K55R, I62V, L63P, A71V, V77I, I85V, F99Y  
>1765-30516| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTIFEDLELPGRWKPKIVGGIGGLVRVRQYDQVP
IEICGHKVISTVLIGPTPTNIVGRNLMTQIGCTLNY

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75VM, M184V, L210W, T215Y   K103NS, Y181C, G190A   T39R, K43E, E44D, K49KR, V118I, K122E, T200A, E203K, Q207D, H208Y, R211K, H221Y, L228LHQ  
>1765-30516| codons 38-247
CRELEEDGKISRIGPENPYNTPVFAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRAKIKELRDYLWKWGFYTP
DKKYQKEPPFQWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006