<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1997 1997-30623 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, L210W, T215Y K219DE K103N, Y181C   K43KN, K49R, V60VI, S68SG, T200A, Q207D, R211K, L228LH G152GE
>1997-30623| codons 38-247
CTEMENEGKISRIGPENPYNTPIFAIKKKNGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQEWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRAKIEELRDHLWKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, L63P, I64IM, A71V, I72T, T74S, V77I, I93L  
>1997-30623| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYDQIP
MEICGHKVTGSVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006