<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1544 1544-30417 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, Y115F, Q151M, M184V D67G, F116Y Y181C, G190A   S68N, W88WR, K122E, D177E, I195IL, I202V, R211K, F214L, V245E  
>1544-30417| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGNTGWRKLVDFRELNKRTQDFREVQLGIPHP
AGLKKKKSVTVLDVGDAFYSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVASDLELGQHRTKVEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, I84A L10F, L33F, L89V I13V, G16GA, R57K, Q61E, L63P, A71I, I72M, V77IT, I93L  
>1544-30417| codons 4-99
TLWQRPFVTVKIAGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFMKVKQYDEIP
IEICGHKIMGTVLTGPTPVNAIGRNVLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006