<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1986 1986-30724 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, T215Y   K103N, Y181C   K43E, E44D, T69TA, D123E, T200A, Q207A, H208Y, R211K, W212C, H221C, V245L I180M
>1986-30724| codons 38-247
CTELEEDGKISKIGPENPYNTPVFAIKKKNSAKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVMCQYMDDLYVGSDLEIGQHRAKIEELRAYLLKCGFYTP
DKKCQKEPPFLWMGYELHPDKWTVQPILLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I50V, I54T, V82A   L10I, I15V, L19I, K20R, E34K, E35D, M36I, R41K, I64V, T74S  
>1986-30724| codons 4-99
TLWQRPIVTIKVGGQIREALLDTGADDTVLKDINLPGKWKPKIIVGVGGFTKVRQYDQIL
VEICGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006