<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1218 1218-30707 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K70KT   A98G E40F, K43E, E53Q, V118I, D121H, K122E, S162Y, D177E, T200A, E203D, H208Y, R211K  
>1218-30707| codons 38-247
CTFLEEEGKISKIGPQNPYNTPVFAIKKKNSTTWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSIPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRAKIDELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33F, F53L L10V, I13V, L24LF, E35D, M36L, N37T, L63P, A71L, V77I, I93L  
>1218-30707| codons 4-99
TLWQRPVVTVKIGGQLKEALFDTGADDTIFEDLTLPGRWKPKIVGGIGGLMKVRQYDQIP
IEICGHKLIGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006