<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1203 1203-30325 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y K219R K103N, Y181C   K43E, K101KQ, V118VI, K122E, I135L, I178IV, E203EK, R211RK, D218DE, K223KQ, L228R  
>1203-30325| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDVVICQYMDDLYVGSDLEIGQHRTKIKELRQHLWKWGFYTP
ERKHQQEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A L33F L10V, I13V, N37HY, R41I, I62V, L63T, T74A, I85V, L89M, T91A  
>1203-30325| codons 4-99
TLWQRPVVTVKIGGQLKEALLDTGADDTVFEEMYLPGIWKPKLIVGIGGFVKVRQYDQVT
IEICGHKAIGAVLVGPTPANIVGRNMLAQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006