<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1686 1686-30401 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y K219N Y181C   T39A, E40F, V118VI, K122E, D123E, I135R, I142V, Q174QK, G196E, Q207E, H208HY, R211K, L228R  
>1686-30401| codons 38-247
CAFLEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSRNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPDIVICQYMDDLYVGSDLEIEQHRTKIEELREYLWKWGFYTP
DNKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54V, I84V, L90M L10F, L33F, K43KT, T74P V11VL, T12K, K14R, I15V, K20T, E34N, M36I, R41K, I62V, L63P, A71V  
>1686-30401| codons 4-99
TLWQRPFLKIRVGGQLTEALLDTGADDTIFNEINLPGKWTPKMIGGIGGFVKVRQYDQVP
IEICGHKVIGPVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006