<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1191 1191-30228 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, I84V, L90M L10F, G73A K20I, E35D, R41K, K55R, R57K, I62V, L63P, H69C, A71T, I72T, Q92QK, I93L  
>1191-30228| codons 4-99
TLWQRPFVTIKIGGQLIEALLDTGADDTVLEDMNLPGKWKPKIIGGIGGFVRVKQYDQVP
IEICGCKTTATVLVGPTPVNVIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103N   K122E, D123DGNS, Q174K, D177E, Q207E, R211K, V245E  
>1191-30228| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006