<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2111 2111-30724 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74V, T215F K219Q Y181C, G190A   T39TA, K43E, K64H, T69N, K122E, Q174H, V179VI, Q207E, D218E, L228H, V245Q  
>2111-30724| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIHKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKHNPDIIICQYMDDLYVASDLEIGQHRTKIEELREHLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M V11VI, G73S L10I, I15IV, A22AV, E34EQ, R41K, I62V, L63P, A71V, I72L, V77I, I85V  
>2111-30724| codons 4-99
TLWQRPIITIKVGGQLKEVLLDTGADDTVLQEMNLPGKWKPKMIGGIGGFVKVRQYDQVP
IEICGHKVLSTVLIGPTPANIVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006