<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1172 1172-30415 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184MV, L210W, T215Y   K103N, Y188L   K43M, E44D, V111I, V118I, K122E, I142V, I178L, H208Y, R211K  
>1172-30415| codons 38-247
CTELEMDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDIGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYVDDLLVGSDLEIGQHRTKIEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L23I, L33F, Q58E, G73S L10I, N37T, D60E, I62V, L63P, A71V, I72K, I93L  
>1172-30415| codons 4-99
TLWQRPIVTIKIGGQLKEAILDTGADDTVFEEMTLPGRWKPKLIGGIGGFVKVREYEQVP
IEICGHKVKSTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006