<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2323 2323-30724 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M V11VI, L33F, Q58E L10I, M36L, K55R, I62V, L63P, I66F, C67G, A71T, I72K, V77I, I93L, C95F  
>2323-30724| codons 4-99
TLWQRPIITIKIGGQLKEALLDTGADDTVFEELNLPGRWKPKIIGGIGGFVRVREYDQVP
IEFGGHKTKGTVLIGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, M184I, T215Y A62V K101E, Y181C A98G V118I, K122E, I135V, K166KR, T200A, E204EG, L228LR  
>2323-30724| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSGKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVICQYIDDLYVGSDLEIGQHRAKIEGLRQHLLRWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006