<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2059 2059-30626 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, G48V, I54M, V82A, L90LM L33F L10I, E34Q, E35D, M36L, N37E, R41RK, L63PT, A71V, I72IV, I93L  
>2059-30626| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTIFQDLELPGKWKPKMVVGIGGFMKVRQYDQIT
IEICGHKVVGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, L210LW T215TN, K219KR Y181YC, G190GA K238KT K43KE, K49KR, K122E, R172RK, Q174QE, I178IM, Q207QEK, H208HY, R211RKM, H221HY, L228LH  
>2059-30626| codons 38-247
CTEMEEEGKISRIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKENPDMVICQYMDDLYVASDLEIGQHRTKIEELRKYLWMWGFNTP
DRKYQKEPPFHWMGYELHPDTWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006