<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1947 1947-30527 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219E K101EQ, Y181C, G190S   T39TA, S68G, T69N, K122E, I135IV, I142V, R211K, L228H  
>1947-30527| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNGNKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVSSDLEIGQHRTKIEELRQHLWKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L33F, G73T L10I, R41RK, L63P, H69HR, K70KR, A71I, I93M  
>1947-30527| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTIFEEMNLPGKWKPKIVGGIGGFLKVRQYDQIP
IEICGRRIITTVLVGPTPVNVIGRNLMTQMGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006