<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1945 1945-30521 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I L10I, R57K, D60E, L63P, A71V, I93L  
>1945-30521| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVKQYEQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74IV, M184V, L210W, T215Y   K103N, Y181C V108I E44ED, V118I, I135T, R211RK, H221Y, V245K  
>1945-30521| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006