<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2236 2236-30725 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V Q58E, L89V L10I, I13V, K20V, P39S, R41K, K55R, L63P, H69Q, A71T, Q92K  
>2236-30725| codons 4-99
TLWQRPIVTVKIGGQLVEALLDTGADDTVLEEMNLSGKWKPKIIGGIGGFVRVREYDQIP
IEICGQKTIGTVLVGPTPVNVIGRNVLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y A62V Y181C, G190A K101H T39A, D177E, Q207E, H208Y, R211K, L228R, V241I  
>2236-30725| codons 38-247
CAELEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYMDDLYVASDLEIGQHRTKIEELREYLLKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTIQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006