<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1489 1489-30320 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82T, L90M   L10R, K20R, E35D, M36I, N37D, I62V, L63P, A71V, I72V, I93L  
>1489-30320| codons 4-99
TLWQRPRVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKIVGGIGGFVKVRQYDQVP
IEICGHKVVGTVLVGPTPTNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y K70KN V106VA F227L E40F, K43KE, V60I, R83K, S105ST, K122E, I135V, I178L, V179I, T200A, Q207K, H208Y, R211E, K223E, L228R  
>1489-30320| codons 38-247
CTFLEEEGKISKIGPENPYNTPIFAIKKKDSTNWRKLMDFRELNKKTQDFWEVQLGIPHP
AGLKKKKTATVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLIIYQYVDDLYVGSDLEIGQHRAKIEELRKYLWEWGFYTP
DKKHQEEPPLRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006