<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2436 2436-30822 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, I84V, L90M L10F, G73C I13V, K14R, K20R, E35D, M36I, N37D, K55KR, R57K, Q61E, I62V, L63P, H69HQ, A71T, I72K, T91TN, Q92K  
>2436-30822| codons 4-99
TLWQRPFVTVRIGGQLREALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFVRVKQYDEVP
IEICGQKTKCTVLVGPTPVNVIGRNLMNKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, V75M, L210W, T215F K219E K101PQ, G190Q   E44D, T69N, K102KR, L109LI, V118I, K122E, D123N, I135T, G196E, H208Y, R211K, L228QR, D237E  
>2436-30822| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSNRWRKIMDFRELNKRTQDFWEVQLGIPHP
AGLQRKKSVTVIDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVQSDLEIEQHRTKIEELRQYLWKWGFFTP
DEKHQKEPPFRWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006