<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1271 1271-30501 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 5

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N K101KDEN, Y181C, G190T K238T E44D, V118I, K122E, I142V, S163C, H208Y, R211K, V245EG  
>1271-30501| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLNKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSCMTKILEPFRKQNPDIVICQYMDDLYVTSDLEIGQHRTKIEELRQYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDTWTVQPIGLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, L63P, I72V, I93IL  
>1271-30501| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006