<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1474 1474-30512 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       T39A, V60VI, A98S, V118VI, K122E, T139K, I142V, S162A, T165TI, Q207E, V245K  
>1474-30512| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNEKPGVRYQYNVLPQGWKGSP
AIFQASMIKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M L33F, G73A L10I, N37S, R41K, K55R, D60E, Q61QH, L63P, I64V, I72L, V77I, I93L  
>1474-30512| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMSLPGKWKPKIIGGIGGFVRVRQYEHIP
VEICGHKALATVLIGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006