<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1145 1145-30401 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K103N, Y181YC   T39A, K43E, E44D, W88WC, A98S, V118I, K122E, T200A, E203D, Q207T, H208Y, R211K, L228H  
>1145-30401| codons 38-247
CAELEEDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFCEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRAKIDELRTYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82A, I84V L24I, L33F, K43T, L89V L10I, I13V, K20R, E35D, M36I, N37E, L63P, A71V, P79S, T91S, I93L  
>1145-30401| codons 4-99
TLWQRPIVTVKIGGQLREALIDTGADDTVFEDIELPGRWTPKLIGGIGGFLKVRQYDQIP
IEICGHKVIGTVLVGSTPANVIGRNVLSQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006